The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Pleckstrin Homology Domain of Mouse APS. To be Published
    Site RSGI
    PDB Id 1v5m Target Id mmt007005031.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13478, Molecular Weight 13550.90 Da.
    Residues 122 Isoelectric Point 6.35
    Sequence nlaakvelvdiqregaxalhggndapqrlrhcavaevrpalrravagerfrleffvppkasrpkisipl saiievrttmplempekdntfvlkvengaeyiletidslqkhswvadiqgcvd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch