The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Gas2 Domain of the Growth Arrest Specific 2 Protein. To be Published
    Site RSGI
    PDB Id 1v5r Target Id mmt007016392.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13565, Molecular Weight 9642.85 Da.
    Residues 84 Isoelectric Point 9.46
    Sequence nllddavkrisedppckcptkfcverlsqgryrvgekilfirmlhnkhvmvrvgggwetfagyllkhdp crmlqisrvdgktsp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch