The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein dmc1. Mol.Cell 14 363-374 2004
    Site RSGI
    PDB Id 1v5w Target Id trt001000153.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14088, Molecular Weight 37960.29 Da.
    Residues 343 Isoelectric Point 5.70
    Sequence gshmkedqvvaeepgfqdeeeslfqdidllqkhginvadikklksvgictikgiqmttrralcnvkgls eakvdkikeaankliepgfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktql shtlcvtaqlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmelld yvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynvavfvtnqmtad pgatmtfqadpkkpigghilahasttrislrkgrgelriakiydspempeneatfaitaggigdake
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.20 Rfree 0.3459
    Matthews' coefficent 4.01 Rfactor 0.2945
    Waters 17 Solvent Content 69.10

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch