.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v66

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the N-terminal domain of SUMO ligase PIAS1 and its interaction with tumor suppressor p53 and A/T-rich DNA oligomers. J.Biol.Chem. 279 31455-31461 2004
    Site RSGI
    PDB Id 1v66 Target Id ar_001000243.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12135, Molecular Weight 7450.55 Da.
    Residues 65 Isoelectric Point 10.29
    Sequence madsaelkqmvmslrvselqvllgyagrnkhgrkhelltkalhllkagcspavqmkikelyrrrf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch