.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v67

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Observation of a calcium-binding site in the gamma-class carbonic anhydrase from Pyrococcus horikoshii. Acta Crystallogr.,Sect.D 64 1012-1019 2008
    Site RSGI
    PDB Id 1v67 Target Id pho001001591.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13999, Molecular Weight 18918.76 Da.
    Residues 173 Isoelectric Point 5.97
    Sequence maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqdnvsihtshg ypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagavvppnkeipdyslvlgvpg kvvrqlteeeiewtkknaeiyvelaekhikgrkri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.238
    Matthews' coefficent 2.21 Rfactor 0.189
    Waters 137 Solvent Content 44.03

    Ligand Information
    Ligands BCT (BICARBONATE) x 1
    Metals CA (CALCIUM) x 1;ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch