.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B. To be Published
    Site RSGI
    PDB Id 1v6e Target Id mmt007003018.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13472, Molecular Weight 9099.76 Da.
    Residues 82 Isoelectric Point 4.77
    Sequence vmvfissslnsfrsekrysrsltiaefkcklelvvgspascmelelygaddkfyskldqedallgsypv ddgcsihvidhsg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch