The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Lactam Utilization Protein from Pyrococcus horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 1v6t Target Id pho001000986.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13957, Molecular Weight 28429.19 Da.
    Residues 255 Isoelectric Point 5.29
    Sequence mrvdlnsdlgesfgryklgldeevmkyitsanvacgwhagdplvmrktvrlakendvqvgahpgypdlm gfgrrymkltpeearnyilyqvgalyafakaeglelqhvkphgalynamvkeedlaraviegildfdkd lilvtlsnsrvadiaeemglkvahevfadraynpdgtlvprgrpgaviedkeeiaervismvkdggira ingewvdlkvdticvhgdnpkaveitsyirkvleeegvkivpmkefir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.227
    Matthews' coefficent 2.35 Rfactor 0.201
    Waters 177 Solvent Content 47.24

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch