.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1573 from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1v6z Target Id ttk003001573.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14746, Molecular Weight 24669.46 Da.
    Residues 228 Isoelectric Point 9.50
    Sequence mrphrafspgltgvlplretrhlvevlrarvgdrftvfdgerealaevvdlgpplryrvleerrperev gvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlravaleaakqsgrvvvp evlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggfaeeevalleargftpvslgrr ilraetaalallalctagegr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.246
    Matthews' coefficent 2.15 Rfactor 0.197
    Waters 499 Solvent Content 42.81

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch