.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v7c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of threonine synthase from Thermus thermophilus HB8: conformational change, substrate recognition, and mechanism. J.Biol.Chem. 278 46035-46045 2003
    Site RSGI
    PDB Id 1v7c Target Id ttk003000028.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14170, Molecular Weight 37007.61 Da.
    Residues 351 Isoelectric Point 8.73
    Sequence mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdrgmtlav skaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqslvhgarivqvegnfddal rltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhalpvgnagnitahwmgykayhalgk akrlprmlgfqaagaaplvlgrpverpetlatairignpaswqgavrakeesggvieavtdeeilfayr ylareegifcepasaaamagvfkllregrlepestvvltltghglkdpataervaelpppvparleava aaagll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.69 Rfactor 0.196
    Waters 885 Solvent Content 53.86

    Ligand Information
    Ligands HEY ((2E)-2-[({3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch