.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v7q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphoglycerate mutase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v7q Target Id ttk003000215.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14286, Molecular Weight 19601.40 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaelagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.59 Rfree 0.241
    Matthews' coefficent 1.75 Rfactor 0.222
    Waters 127 Solvent Content 29.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch