The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ubiquitin domain from mouse D7Wsu128e protein. To be Published
    Site RSGI
    PDB Id 1v86 Target Id mmt007005237.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13481, Molecular Weight 8824.99 Da.
    Residues 82 Isoelectric Point 9.48
    Sequence dagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvmykglvpedktlreikv tsgakimvvgsti
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch