The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein. To be Published
    Site RSGI
    PDB Id 1v89 Target Id hsk002000050.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12569, Molecular Weight 12417.73 Da.
    Residues 105 Isoelectric Point 8.68
    Sequence pikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctikeiatnpeeagkfvfeii paswdqnrmgqdsyvlmassqaemeewvkflrrvag
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch