The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of MoaD related protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8c Target Id ttk003000253.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14306, Molecular Weight 18642.20 Da.
    Residues 169 Isoelectric Point 4.85
    Sequence mpkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegrdvrylqgl stplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrlpgavvrfreveplkvgs lsipqlrvevegeeaerwferiafaasrggg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.247
    Matthews' coefficent 1.94 Rfactor 0.221
    Waters 558 Solvent Content 36.08

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch