.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glycerophosphoryl diester phosphodiesterase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v8e Target Id ttk003000487.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14379, Molecular Weight 24402.79 Da.
    Residues 224 Isoelectric Point 5.44
    Sequence mtafrqrplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqvdy adlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwvssfdplallal rkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrglfvvawtvneegearrllalg ldgligdrpevllplgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2349
    Matthews' coefficent 2.14 Rfactor 0.2047
    Waters 291 Solvent Content 41.96

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch