.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v8i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal. J.Biol.Chem. 279 37163-37174 2004
    Site RSGI
    PDB Id 1v8i Target Id ttk003001345.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14692, Molecular Weight 19262.94 Da.
    Residues 170 Isoelectric Point 5.03
    Sequence mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli epgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedeaievvwmrp eealerhqrgevefsatglvgvlyyhaflrgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.236
    Matthews' coefficent 2.36 Rfactor 0.213
    Waters 59 Solvent Content 47.55

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch