.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v8q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8. Protein Sci. 13 2806-2810 2004
    Site RSGI
    PDB Id 1v8q Target Id ttk003000826.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14447, Molecular Weight 9507.58 Da.
    Residues 85 Isoelectric Point 11.67
    Sequence mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvef qdrgrlgryvhvrpla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.236
    Matthews' coefficent 2.15 Rfactor 0.197
    Waters 18 Solvent Content 42.78

    Ligand Information
    Ligands DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch