The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal. J.Biol.Chem. 279 37163-37174 2004
    Site RSGI
    PDB Id 1v8w Target Id ttk003001345.9
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14702, Molecular Weight 19261.96 Da.
    Residues 170 Isoelectric Point 5.11
    Sequence mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipagli epgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedeaievvwmrp eealerhqrgevefsatglvgvlyyhaflrgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.227
    Matthews' coefficent 2.34 Rfactor 0.221
    Waters 57 Solvent Content 47.11

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch