The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 5,10-Methylenetetrahydrofolate reductase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v93 Target Id ttk003000187.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14263, Molecular Weight 33000.09 Da.
    Residues 296 Isoelectric Point 8.98
    Sequence mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrersvawaqriqs lglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrphpegfryaaelvalirery gdrvsvggaaypeghpesesleadlrhfkakveagldfaitqlffnnahyfgflerarragigipilpg impvtsyrqlrrftevcgasipgpllaklerhqddpkavleigvehavrqvaelleagvegvhfytlnk spatrmvlerlglrpasgqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.236
    Matthews' coefficent 2.40 Rfactor 0.199
    Waters 230 Solvent Content 48.72

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1;DIO (1,4-DIETHYLENE) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch