.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v98

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic Analysis of Thioredoxin from the Thermophilic Bacteria Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1v98 Target Id ttk003000396.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14361, Molecular Weight 15160.97 Da.
    Residues 140 Isoelectric Point 9.24
    Sequence mvvtcpkcgaknrlgtpppgqvpvcgacktplpwvveadekgfaqevagapltlvdffapwcgpcrlvs pileelardhagrlkvvkvnvdehpglaarygvrsvptlvlfrrgapvatwvgasprrvleerlrpyle gr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.236
    Matthews' coefficent 2.43 Rfactor 0.195
    Waters 197 Solvent Content 48.98

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch