.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v99

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Periplasmic divalent cation tolerance protein CutA from Pyrococcus Horikoshii Ot3 in the presence of CuCl2. To be Published
    Site RSGI
    PDB Id 1v99 Target Id pho001000992.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13960, Molecular Weight 12347.57 Da.
    Residues 102 Isoelectric Point 4.91
    Sequence miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktredlweelkeri kelhpydvpaiiridvddvnedylkwlieetkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.225
    Matthews' coefficent 1.73 Rfactor 0.189
    Waters 688 Solvent Content 28.48

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 4;SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 8;CU (COPPER) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch