The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus. To be published
    Site RSGI
    PDB Id 1v9c Target Id ttk003000210.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14272, Molecular Weight 23213.59 Da.
    Residues 218 Isoelectric Point 6.93
    Sequence mtekgraieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveaglkaiqagari lvdarmiacglnperlrlfgnevvellahpevvarakatggtraeaavayawekglldgaivgvgnapt fllalveairqgarpalvlgmpvgfvnvleakralmeapvpwivtegrkggstlvvaalhalirlaadg gvdtsrayreg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.27
    Matthews' coefficent 2.15 Rfactor 0.221
    Waters 151 Solvent Content 42.35

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch