.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v9j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a BolA-like protein from Mus musculus. Protein Sci. 13 545-548 2004
    Site RSGI
    PDB Id 1v9j Target Id mmk001000564.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13423, Molecular Weight 10214.08 Da.
    Residues 86 Isoelectric Point 5.81
    Sequence melsadylreklrqdleaehvevedttlnrcatsfrvlvvsakfegkpllqrhrlvneclaeelphiha feqktltpeqwtrqrre
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch