The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C subunit of V-type ATPase from Thermus thermophilus at 1.85 A resolution. Acta Crystallogr.,Sect.D 60 810-815 2004
    Site RSGI
    PDB Id 1v9m Target Id ttk003000375.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14356, Molecular Weight 35916.55 Da.
    Residues 323 Isoelectric Point 8.47
    Sequence maddfaylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravlrtqaklv gdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlreevwrqayeaqdpagmaq vlavpghplaralravlretqdlarveallakrffedvakaakgldqpalrdylalevdaenlrtafkl qgsglapdafflkggrfvdrvrfarlmegdyavldelsgtpfsglsgvrdlkalerglrcvllkeakkg vqdplgvglvlayvkereweavrlrllarrayfglpraqveeevvcp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.228
    Matthews' coefficent 2.16 Rfactor 0.202
    Waters 165 Solvent Content 43.10

    Ligand Information
    Ligands GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch