.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vat

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Multi-wavelength anomalous diffraction method for I and Xe atoms using ultra-high-energy X-rays from SPring-8. J.Appl.Crystallogr. 37 925-933 2004
    Site RSGI
    PDB Id 1vat Target Id my_001000041.1
    Molecular Characteristics
    Source Gallus gallus
    Alias Ids TPS13718, Molecular Weight 14312.37 Da.
    Residues 129 Isoelectric Point 9.32
    Sequence kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqinsrwwcndgrt pgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdvqawirgcrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.232
    Matthews' coefficent 1.89 Rfactor 0.205
    Waters 94 Solvent Content 34.27

    Ligand Information
    Ligands
    Metals IOD (IODIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch