The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Multi-wavelength anomalous diffraction method for I and Xe atoms using ultra-high-energy X-rays from SPring-8. J.Appl.Crystallogr. 37 925-933 2004
    Site RSGI
    PDB Id 1vau Target Id my_001000041.2
    Molecular Characteristics
    Source Gallus gallus
    Alias Ids TPS13719, Molecular Weight 14312.37 Da.
    Residues 129 Isoelectric Point 9.32
    Sequence kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqinsrwwcndgrt pgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdvqawirgcrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.203
    Matthews' coefficent 1.77 Rfactor 0.187
    Waters 124 Solvent Content 29.80

    Ligand Information
    Metals XE (XENON) x 3;CL (CHLORIDE) x 2;NA (SODIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch