.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of type 2 malate/lactate dehydrogenase from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1vbi Target Id ttk003001327.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14684, Molecular Weight 36945.28 Da.
    Residues 344 Isoelectric Point 6.48
    Sequence mrwradflsawaeallrkagadepsakavawalveadlrgvgshgllrlpvyvrrleaglvnpsptlpl eergpvalldgehgfgprvalkaveaaqslarrhglgavgvrrsthfgmaglyaeklaregfvawvttn aepdvvpfggrekalgtnplafaapapqgilvadlatsesamgkvflarekgerippswgvdregsptd dphrvyalrplggpkgyalallvevlsgvltgagvahgigrmydewdrpqdvghfllaldpgrfvgkea flermgalwqalkatppapgheevflpgelearrreralaegmalpervvaelkalgerygvpwrdda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21
    Matthews' coefficent 2.67 Rfactor 0.187
    Waters 342 Solvent Content 53.60

    Ligand Information
    Ligands SO4 (SULFATE) x 3;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1;EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch