.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 1vbq Target Id ttk003000896.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14481, Molecular Weight 54670.83 Da.
    Residues 480 Isoelectric Point 6.19
    Sequence mglviydtlarrkvpfepavpghvgiyvcgptvyadphlghargpvvydvlrryllhkgykvrfvsnit dvghltddadegedkivrraklerlepmevaekytwsyfdamqalnvlrpsiaprasghipemlelter llargvayerkgsvyfrvrsfpeygklsgkrleelragarvevreekedpldfalwkaaepghimrwks pwgegypgwhiectamslkylgegfdlhaggidlqfphheceiaqaeaagfrfarhwmhhnhvllegek makstgnlvllhdlleahepmalrfyllqthyrspmdftweglesakrgygrllhayrevrgrkktapp gttpeleraldalekafmeaieddlstpealaalfaflpelhkllpeakaeslaraeavfhtlgegilg lfpervleervsgplleglialllelreearrakdyeksdlirerlralgvivedtkegprwrler
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch