.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vc2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Glyceraldehyde 3-Phosphate Dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1vc2 Target Id ttk003000466.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14374, Molecular Weight 35891.38 Da.
    Residues 331 Isoelectric Point 8.42
    Sequence mkvgingfgrigrqvfrilhergvevalindltdnktlahllkydstygrfpgavgydeenlyvdgkai rataikdpreipwkqagvgvvvestgvftdgekarahleagakkviitapakneditvvlgvnheqydp akhhilsnascttnslapvmkvlekafgvekalmttvhsytndqrlldlphkdlrraraaalniipttt gaakatalvlpslkgrfdgmalrvptptgsisditallkrevtaeevnaalkaaaegplkgilaytede ivlrdivmdphssivdgkltkaignlvkvfawydnewgyanrvadlvelvlkkgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.286
    Matthews' coefficent 2.57 Rfactor 0.225
    Waters 33 Solvent Content 51.68

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch