.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vc3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-Aspartate-alpha-Decarboxylase. TO BE PUBLISHED
    Site RSGI
    PDB Id 1vc3 Target Id ttk003000264.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14313, Molecular Weight 13094.34 Da.
    Residues 120 Isoelectric Point 5.74
    Sequence mkrvmfhakihratvtqadlhyvgsvtvdqdlldaagilpfeqvdiyditngarlttyalpgergsgvi gingaaahlvkpgdlvilvaygvfdeeearnlkptvvlvdernrilevrkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2469
    Matthews' coefficent 2.08 Rfactor 0.2151
    Waters 158 Solvent Content 40.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch