The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Indole-3-Glycerol Phosphate Synthase (TrpC) from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1vc4 Target Id ttk003000016.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14159, Molecular Weight 27417.12 Da.
    Residues 254 Isoelectric Point 5.49
    Sequence mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseglirevdpve aalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfmleearafgasaallival lgeltgayleearrlglealvevhtereleialeagaevlginnrdlatlhinletaprlgrlarkrgf ggvlvaesgysrkeelkaleglfdavligtslmrapdleaalrelvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.218
    Matthews' coefficent 2.08 Rfactor 0.186
    Waters 683 Solvent Content 40.77

    Ligand Information
    Ligands SO4 (SULFATE) x 10;ACY (ACETIC) x 5;GOL (GLYCEROL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch