.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vcg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of IPP isomerase at P43212. To be Published
    Site RSGI
    PDB Id 1vcg Target Id ttk003001255.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14669, Molecular Weight 36016.80 Da.
    Residues 332 Isoelectric Point 6.58
    Sequence mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamtgg eengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygrddll rlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalalrdlpla avdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplvasggvytgtdgakala lgadllavarpllrpalegaervaawigdyleelrtalfaigarnpkeargrverv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.02 Rfree 0.262
    Matthews' coefficent 3.08 Rfactor 0.24
    Waters Solvent Content 59.70

    Ligand Information
    Ligands FMN (FLAVIN) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch