The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1vch Target Id ttk003000096.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14224, Molecular Weight 19332.68 Da.
    Residues 175 Isoelectric Point 6.32
    Sequence metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttetspiplthv laealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaekllnqrvvlvsdvvasgetmra mekmvlragghvvarlavfrqgtpglavdtvaelpvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.259
    Matthews' coefficent 2.72 Rfactor 0.232
    Waters 373 Solvent Content 54.39

    Ligand Information
    Ligands ACY (ACETIC) x 4
    Metals CL (CHLORIDE) x 5;CA (CALCIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch