.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vco

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of CTP Synthetase Reveal ATP, UTP, and Glutamine Binding Sites. Structure 12 1413-1423 2004
    Site RSGI
    PDB Id 1vco Target Id ttk003000122.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14231, Molecular Weight 60999.82 Da.
    Residues 550 Isoelectric Point 6.39
    Sequence mngsadagprprkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgev fvtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitdeikerirk vaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpyletseefktkptqhsva tlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssptvehlyevpllleeqglgraveralg leavipnlsfwqeavrvlkhpertvkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesle aadldeafrdvsgilvpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganst efdphtphpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgl eraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfveaalayqera
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.27
    Matthews' coefficent 3.09 Rfactor 0.236
    Waters 240 Solvent Content 59.88

    Ligand Information
    Ligands GLN x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch