.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vdk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fumarase from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1vdk Target Id ttk003000543.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14412, Molecular Weight 50879.75 Da.
    Residues 466 Isoelectric Point 6.30
    Sequence meyrierdtmgevrvpadkywgaqtqrslenfrigtdrfrmpleiiraygmlkkaaaranlelgelpee iakaiiqaaeevvqgkwddhfplvvfqtgsgtqtnmnvnevianraseilgkplgskyvhpndhvnrgq ssndtfptamyvavalalhqrlypaveglirtftakaqafdqivkvgrthlmdavpitlgqeigswaaq lkttlaavkemekglynlaiggtavgtglnahprfgelvakylaeetglpfrvaenrfaalaahdelvn vmgairtlagalmkigndvrwlasgpyagigeitipanepgssimpgkvnptqvealtmvvvrvygndh tvafagsqgnfqlnvykpvmaystlesinlladavasfdahlaqgiepnlerieehlqknpmlatalnk aigydkaaeivkkalkekktlkqaalelgylteeefdrivvpmrlakphega
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.201
    Matthews' coefficent 2.92 Rfactor 0.185
    Waters 648 Solvent Content 57.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch