.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vdm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of purine phosphoribosyltransferase from Pyrococcus horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 1vdm Target Id pho001000095.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13761, Molecular Weight 17574.84 Da.
    Residues 153 Isoelectric Point 6.18
    Sequence mdkvyltwwqvdraifalaeklreykpdviigvargglipavrlshilgdiplkvidvkfykgiderge kpvitipihgdlkdkrvvivddvsdtgktlevvieevkklgakeikiaclamkpwtsvvpdyyvfrtek wivfpweefpvieke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.50 Rfree 0.241
    Matthews' coefficent 3.36 Rfactor 0.209
    Waters 749 Solvent Content 63.35

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch