.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vdw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical protein PH1897 from Pyrococcus horikoshii with similarities for Inositol-1-monophosphatase. To be Published
    Site RSGI
    PDB Id 1vdw Target Id pho001001897.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14014, Molecular Weight 28018.65 Da.
    Residues 254 Isoelectric Point 5.31
    Sequence msvktwrkiaidiirdfdhnimplfgnpkasetisispsgdetkvvdkvaeniiiskfkdlgvnvvsee igridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepiverlyegipgkgsylnge kikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialelaylargaldavvdirnylrptdiaagvv iareagaivkdldgkdveitfsatekvniiaanneelletilrsiek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.217
    Matthews' coefficent 2.31 Rfactor 0.208
    Waters 787 Solvent Content 46.83

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 7
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch