.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vdx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative 2'-5' RNA ligase from Pyrococcus horikoshii. Acta Crystallogr.,Sect.D 61 1207-1212 2005
    Site RSGI
    PDB Id 1vdx Target Id pho001000099.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13762, Molecular Weight 21094.43 Da.
    Residues 184 Isoelectric Point 6.87
    Sequence mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeiknilkkiaekyk khevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkegnfvahitlgrvkfvkdkl gltmklkelanedfgsfvvdaielkkstltpkgpiyetlarfelse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.274
    Matthews' coefficent 2.21 Rfactor 0.225
    Waters 41 Solvent Content 44.30

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch