.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ve3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0226 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 1ve3 Target Id pho001000226.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13798, Molecular Weight 26789.56 Da.
    Residues 227 Isoelectric Point 6.67
    Sequence mgfkeyyrvfptytdinsqeyrsrietlepllmkymkkrgkvldlacgvggfsflledygfevvgvdis edmirkareyaksresnvefivgdarklsfedktfdyvifidsivhfeplelnqvfkevrrvlkpsgkf imyftdlrellprlkeslvvgqkywiskvipdqeertvviefkseqdsfrvrfnvwgktgvellaklyf tkeaeekvgnysyltvynpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.27
    Matthews' coefficent 2.28 Rfactor 0.236
    Waters 178 Solvent Content 46.00

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch