The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-Dimensional Strutcure of Acetylornithine aminotransferase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1vef Target Id ttk003000044.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14202, Molecular Weight 43420.99 Da.
    Residues 395 Isoelectric Point 6.66
    Sequence metrtledwralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevvea vkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfarahtgrkkfvaamr gfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaavilepvqgeggvrpatpef lraareitqekgallildeiqtgmgrtgkrfafehfgivpdiltlakalgggvplgaavmreevarsmp kgghgttfggnplamaagvaairylertrlweraaelgpwfmeklraipspkirevrgmglmvglelke kaapyiarlekehrvlalqagptvirflpplviekedlervveavravla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.35 Rfree 0.209
    Matthews' coefficent 2.18 Rfactor 0.195
    Waters 383 Solvent Content 43.49

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch