.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vfg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for template-independent RNA polymerization. Nature 430 700-704 2004
    Site RSGI
    PDB Id 1vfg Target Id ar_001000505.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12174, Molecular Weight 45639.40 Da.
    Residues 390 Isoelectric Point 9.37
    Sequence mvgqiakemglrayivggvvrdillgkevwdvdfvvegnaielakelarrhgvnvhpfpefgtahlkig klklefatarretyprpgaypkvepaslkedlirrdftinamaisvnledygtlidyfgglrdlkdkvi rvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlineiklalredrfle ilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridygwlyllilisnldyergkhf leemsapswvretykfmkfklgslkeelkkakenyevyrllkplhtsvllllmleeelkekiklylekl rkvklpkekieelkkqglkgkelgerieelkreimnkiklaaale
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.2865
    Matthews' coefficent 4.10 Rfactor 0.2297
    Waters 79 Solvent Content 70.00

    Ligand Information
    Ligands APC (DIPHOSPHOMETHYLPHOSPHONIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch