.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Vanabin2, a Vanadium(IV)-Binding Protein from the Vanadium-Rich Ascidian Ascidia sydneiensis samea. J.Am.Chem.Soc. 127 4216-4222 2005
    Site RSGI
    PDB Id 1vfi Target Id ar_001000080.1
    Molecular Characteristics
    Source Ascidia sydneiensis samea
    Alias Ids TPS12121, Molecular Weight 13224.72 Da.
    Residues 120 Isoelectric Point 8.23
    Sequence mskvifalvlvvvlvacinatyvefeeayapvdckgqcttpcepltackekcaescetsadkktcrrnc kkadcepqdkvcdacrmkchkacraancasecpkhehksdtcracmktnck
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch