.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein TT1634 from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1vgg Target Id ttk003001634.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14760, Molecular Weight 17635.72 Da.
    Residues 161 Isoelectric Point 5.83
    Sequence melklipiekpenlnvilgqahfiktvedlhealvtavpgirfglafseasgkrlvrrsgtdealvela vknllnlacghvflivlgegfypinvlhavkacpevvriyaatanplkvvvaeegeqrailgvmdgftp lgvedeaevawrkdllrrlgykl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.75 Rfree 0.204
    Matthews' coefficent 2.03 Rfactor 0.18
    Waters 455 Solvent Content 38.89

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch