.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vs3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tRNA Pseudouridine Synthase TruA from Thermus thermophilus HB8. Rna Biol. 3 115-121 2006
    Site RSGI
    PDB Id 1vs3 Target Id ttk003000910.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14494, Molecular Weight 28132.18 Da.
    Residues 253 Isoelectric Point 9.66
    Sequence mrrllllceydgtlfaglqrqgrglrtvqgeleralpgigalpkavaagrtdagvhalampfhvdvesa ipvekvpealnrllpedlkvvgarevapdfharkdalwrayryrilvrphpspllrhralwvrrpldle ameealslllgrhnflgfakeetrpgerellearlqvaegeaglevrlyfrgksflrgqvrgmvgtlle vglgkrppeslkailktadrrlagptapahglyfveaaypeeklsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.234
    Matthews' coefficent 3.09 Rfactor 0.222
    Waters 565 Solvent Content 60.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch