.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wd7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal). to be published
    Site RSGI
    PDB Id 1wd7 Target Id ttk003001434.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14723, Molecular Weight 28398.55 Da.
    Residues 261 Isoelectric Point 9.46
    Sequence mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv gvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpqgrgvaalql ygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalafvaaiqveflfegakdpka lrealntrvkalavgrvtadalrewgvkpfyvdeterlgsllqgfkralqkeva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.255
    Matthews' coefficent 2.09 Rfactor 0.224
    Waters 463 Solvent Content 41.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch