.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of TT0907 From Thermus Thermophilus HB8. To be published
    Site RSGI
    PDB Id 1wdi Target Id ttk003000907.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14493, Molecular Weight 38426.64 Da.
    Residues 345 Isoelectric Point 7.13
    Sequence megleaydyhlppeqiaqegveprdmarlmvvyregpfrvahkrvrdlpeflrpgdvlvfneskvipar llarkptggkveillvrerspglweallgparkappgtrllllspkdlapvpglqaevvaveedgvrll rfqgdlvahleevgevplppyikakipmeryqtvyarrpgsvaaptaglhftpellerlremgvelrfl tlhvgpgtfrpvkgdpekhemhaepyaipeevaeavnrakaegrrvvavgttvvralesayregvgvva gegetrlfirppytfkvvdalftnfhlprstllmlvaaflgrertleayrlavaegyrfyslgdamlil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.27
    Matthews' coefficent 2.80 Rfactor 0.237
    Waters 178 Solvent Content 56.00

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch