.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of TT1808 From Thermus Thermophilus HB8. To be published
    Site RSGI
    PDB Id 1wdj Target Id ttk003001808.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14797, Molecular Weight 20781.49 Da.
    Residues 187 Isoelectric Point 4.94
    Sequence mplvldlarpvseeelrrlselnpgyqwerspegrlwvsptggesgrrslqlayqlarwneerglgvvf dsstgfkfpdgsilspdaafvergawealseaeregfpplapkavfevrsasqdpeelrakmgiylrng vllgvlvdpyaravevfrpgkpplrlegvervsldpelpgfalslpplw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.241
    Matthews' coefficent 2.10 Rfactor 0.189
    Waters 255 Solvent Content 41.50

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch