.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ttk003000868 from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 1wdt Target Id ttk003000868.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14463, Molecular Weight 73133.66 Da.
    Residues 665 Isoelectric Point 5.28
    Sequence mgteggamirtvalvghagsgkttlteallyktgakerrgrveegttttdytpeaklhrttvrtgvapl lfrghrvflldapgygdfvgeirgaleaadaalvavsaeagvqvgterawtvaerlglprmvvvtkldk ggdyyalledlrstlgpilpidlplyeggkwvglidvfhgkayryengeereaevppeerervqrfrqe vleaivetdegllekylegeevtgealekafheavrrgllypvalasgereigvlpllelilealpspt erfgdgpplakvfkvqvdpfmgqvaylrlyrgrlkpgdslqseagqvrlphlyvpmgkdlleveeaeag fvlgvpkaeglhrgmvlwqgekpeseevpfarlpdpnvpvalhpkgrtdearlgealrklleedpslkl erqeetgelllwghgelhlatakerlqdygvevefsvpkvpyretikkvaegqgkykkqtgghgqygdv wlrlepaseygfewritggvipskyqeaieegikeaakkgvlagfpvmgfkaivyngsyhevdssdlaf qiaaslafkkvmaeahpvllepiyrlkvlapqervgdvlsdlqarrgrilgmeqegalsvvhaevplae vleyykalpgltggagaytlefshyaevpphlaqrivqeraqeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.241
    Matthews' coefficent 2.70 Rfactor 0.197
    Waters 283 Solvent Content 54.40

    Ligand Information
    Ligands GTP (GUANOSINE-5'-TRIPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch