.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative trans-editing enzyme for prolyl-tRNA synthetase from Aeropyrum pernix K1 at 1.7 A resolution. Acta Crystallogr.,Sect.F 61 26-29 2005
    Site RSGI
    PDB Id 1wdv Target Id ape001002540.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12119, Molecular Weight 16320.28 Da.
    Residues 152 Isoelectric Point 7.95
    Sequence mlekveewikargltwrllimqkptrtvaeaaallgvseseivktlivldnaggvyavvipgdkrlnin smkelagkpvrlaranevveltgypvggvppvalppnivlvvdrillsrkkvyggggrenallefspre lveatgavvadvse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.206
    Matthews' coefficent 1.93 Rfactor 0.169
    Waters 503 Solvent Content 36.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch