.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wee

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PHD domain in PHD finger family protein. To be Published
    Site RSGI
    PDB Id 1wee Target Id atr001000671.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12231, Molecular Weight 6647.27 Da.
    Residues 59 Isoelectric Point 5.48
    Sequence mergvdnwkvdckcgtkdddgermlacdgcgvwhhtrciginnadalpskflcfrciel
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch