.
The Open Protein Structure Annotation Network
PDB Keyword
.

1weh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8. PROTEIN SCI. 13 3038-3042 2004
    Site RSGI
    PDB Id 1weh Target Id ttk003001887.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14818, Molecular Weight 18463.48 Da.
    Residues 171 Isoelectric Point 6.61
    Sequence mrllavfvssrlspedplyarwvrygevlaeegfglacggyqggmealargvkakgglvvgvtapaffp errgpnpfvdlelpaatlpqrigrlldlgagylalpggvgtlaelvlawnllylrrgvgrplavdpywl gllkahgeiapedvgllrvvadeedlrrflrsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.223
    Matthews' coefficent 2.11 Rfactor 0.185
    Waters 403 Solvent Content 41.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch